GenomeNet

>ctjs:CTRC122_03885 K03524 BirA family transcriptional regulator, biotin operon repressor / biotin---[acetyl-CoA-carboxylase] ligase [EC:6.3.4.15] | (GenBank) biotin--protein ligase (A)
MKEIYYEIARTESTNTTAKEGLSLWDPYALTVITTREQTAGRGKFGRVWHSTDQDLLASF
CFFLSVNNVDSALLFRIGTEAVMRLGESLGIQEAVMKWPNDVLVQGKKLSGVLCETIPVK
TGTCVIIGIGVNGNVGADELLGIDQPATSLQELIGRPVDMEEQLKRLTKEIKHLIQTLPL
WGRE

BLAST