GenomeNet

>cyq:Q91_0965 K15756 2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoate hydrolase [EC:3.7.1.13] | (GenBank) Alpha/beta hydrolase fold protein (A)
MNEADFETKYIDVNGVKTCYIEEGQGEPVILIHGGGAGANSYGNWFASLPLFGKKFRAIA
IDMIGFGKSEGPAVIGADCSQKTRYDHLAGFIKAMGFEKATLVGNSMGGATAMGVAIEYP
ELVDKLVLMGSAGLNTEISEALMPILKYDFTKEGMVKMVQALTNDDFVITDEMIDYRFAN
SIDPSNKEAYGNVMEWIKSQGGLFYEDEYIAKITQKTLVVNGKNDLVVPLTHAHKFLELI
NDSWGYIVPHCGHWAMIEHPEDFASAVSQFIESH

BLAST