GenomeNet

>cyt:cce_2420 K06147 ATP-binding cassette, subfamily B, bacterial | (GenBank) ATP-binding protein of ABC transporter (A)
MKHKLLQLCLNTETNSINHNFFQINNKSKTMISWKDLLKSYHNHRSIAVYSILASGALQI
VDLMVPYITGQIINVLSHQPIDSILENLVNSLANITNFPNNQIFSLAVLLGIIFVVTVVR
SPIQPWLTDWFHWEIALKVRREQLKNTVRKILTLPLSFYDEYNPGRITNRIAKGVENQLW
TYPEIAGELMPKIIRVLGIFVIILLIEWKIALLFLISFTLILFFSIKHLNKILKQEELLD
KHSENTQSFSSELITNIKTVKAFATERRELSRQDKRLDREFKYVLFRIHTGYVKLVTWQK
TVIQSSVFLILVYSLIITVQGHISLGHFITLITVSSMAYAELDPITQLAEIFARRYSSIS
RFHEFLHIPSGEDKAILTQESINHEPYQFTGKIHLSNLSFAYHENHWVLQNINLLIHPYE
TVAIVGKSGSGKSTLIKLLLRYFKPTQGQILIDGKDIQTLDIVQYRQRLAMVHQEVEIFN
GTLLDNLTYGNRTVSFEAVEQACQIARVDEFITQFPQGYYTIVGERGVRLSGGQRQRIGI
ARALIVDPDVLIFDEATSSLDYESEKLIQLAMSSILGTRTTIIIAHRLSTVREADKIIVL
DNGQIVEVGNHQQLLNHQGIYHRLHSLQETGELS

BLAST