GenomeNet

>dav:DESACE_00030 K02469 DNA gyrase subunit A [EC:5.6.2.2] | (GenBank) DNA gyrase subunit A (A)
MKDLFERVIKTNIIDTMKKSYIDYSMSVIVGRALPDARDGLKPVHRRILYAASELDLLHN
KPYKKSARVVGDVIGKYHPHGDTSVYDAMVRMSQEFTMRYPLIDGQGNFGSIDGDSPAAM
RYTEVRLSKIAEELLKDLDKDTVDFQPNYDESLKEPTVLPSLIPNLLVNGSSGIAVGMAT
NIAPHNLGEVIDALIYYIDSKRTAQTKELLNFIKGPDFPTGAIVMCDSLEEIYEKGLGKI
KIRSLAKIEKIGNKHAIIIEEIPYQVNKANLVKDIAQLVKDKQIEGISDLRDESNKEGIR
IVIEVKSSEQPEIILNNLYKISNLEVSFSINNLCLVDNVPKVLSLKEYFNVFLDFREQVI
KRRTIYLLNIAKERIHILEGLKIAVQNIDEVISIIKKSQTPQIAKDRLKERFNLSDKQTN
AILEMRLSRLTGLEIEKLEKEYNEILEKIKNYEKILGNYDELVSIVKSELIYIKENYSDR
RRTQIVTKLEEINKEDLVKQEKLLITFSNKGYIKSIPLSFYNVQSRGGKGRIAAVYSEDD
YILDCLVLDSLDVVLMFSNNGRIYSIKAYEIPKSSNYTKGKAIVNLLNLKNNEQIKTINA
YKPGNDYVLITQKGIIKRISSDNFSDIKSNGRTIINLLNDDQLVCVIPNVSEKDEIIICT
SLGQSVRFGIEQVRKMGRNAYGVKGISLADNDYVVSGFKLQNKEEKIVLITQNGIAKVIL
ADSIRKVSRGAKGVKIIKLKGEDRLVDAERLQDNSEILITTKLGKLIRIDSNQFREMSRY
AYGVKAIELESDDSVVKVNVTKDQYCDI

BLAST