GenomeNet

>dhd:Dhaf_1520 K02434 aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7] | (GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit (A)
MSIFERYEMVCGVEVHVELATKTKIFCNCSTEFGGEQNTHVCPVCLGLPGVLPVLNREVV
NLAIKAGLALNCDIADFSKFDRKNYFYPDAPKNFQTSQYDLPICKNGWLEFAVDGEKKRV
GITRAHMEDDAGKLVHSGATISTSEESFVDYNRTGVPLLEIVSEPDMRSIAEVVSFLEEM
VRTIQYTEVSDCRMEQGSVRFDINVSLRPHGQKEFGTRTETKNLNSFSSVRRCLEYEIER
QARLLDDGEKVIQETRTWDEGKGVTLSLRSKEEAHDYRYFPEPDLVPLVIAREWVEEIRQ
TLPEMPGARRERYQSLGLTEYDAGVLTAAKALSDFFDEALQSYSDAKALANWVMGEFTRL
LNAKQISVEESPVRPSQLAELLTLIEKGAISGKIGKTVIEAMFESGKDPEVIIKEKGLAQ
ISDTAALLKLVDEVIAAHPQSVEDYKAGKDRAIGFLVGQIMKATKGQANPGVVNDLLKEQ
LAKF

BLAST