GenomeNet

>din:Selin_1638 K03387 NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-] | (GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase (A)
MSGEKVYDVIIAGLGPAGESAAIYTARKNLSTLIVAYDSGGQLTKTFDVENYLGIPYSTG
WEMAMKFEEHVRKYSNVEIELMQEVVAIEDHGTTKKFITAEGREFQGRSAIIATGAKPKT
VGVKNEEKFNGKGLTYCTTCDGPLYRNKIVTIIGGGTSGVEAALEMVKIASKVQLIVRSQ
LRAEPILMDRLKEVSVDIYENTIPVEILGDEYVTGLRIRDRNSSVEQELTTDGIFVEIGR
APNADGLKNLLQTNDNGEIVISTYNETNIPGVFAAGDVTDVKFKQVIIAAGEGAKAAMKV
SEYLIKQGQK

BLAST