GenomeNet

>dme:Dmel_CG11630 no KO assigned | (RefSeq) CG11630; uncharacterized protein (A)
MCSCSIRCCFLYSLIIFSFVYYYNDVVVDNIIFEEHHLVEKYSVDTKGCRMLTMVPNEYD
VMFLWRGLRRDFCASNLNLTSFSNCTYNYLRTEVNMELAKARFGVETLESFKCMYYAMER
HTDFDNRYLYSREFELLTDGNNTIEPHADIIRAECFINATSIYNGVHFYVHPTDEWLRTA
QGLPPLKLASDVGSLSVLIVGLDSISQMHFHRSMARTANFLLSLPHVELKGFNRLGEDGF
DSLMPLLSGLSGQELKDVSSNLSSLDSCPFIWKVFQKAGYETGLGEDNIDKSLFVKGFRK
PPTDFYLRPALLEMWLKTRTDGLFGTHCNEKDNYAMVLREFLFKMLPHHTSHRFFTFLWW
TQGIDHLFNYGRKLDQPFLKMFKAIGRSGLLKNTVLLVVSNHGLNKGRFYKTVQGKVEES
QPLAILCYPRWLEERYPQAIGNLKSNNRRLVTAFDLHATLQNLPNLTSLEDEQLQQRRVD
LWAMGKDIPRGISLFLPIPDHRDCFLAAIPTANCLCQQPRNVSTSDGYVQRAARLIIRNL
NKMIHTHTPPCKTLYLDRVLTADKWRRIADEHQSEFRVRLIATPGEGQFEGIVRYTGYKL
AVDGHISRVNDYRNGSQCIRNYLIEMYCFCP

BLAST