GenomeNet

>dpte:113793994 K03648 uracil-DNA glycosylase [EC:3.2.2.27] | (RefSeq) uncharacterized protein LOC113793994 (A)
MSKQKTITNFFKRKIIDEIDNGAISKKHCINAVVGGGDDSSNDKRSNDNSGDNRNDDDRR
RVACGYISTKWYKIFEQEFQKQYFKNLEKFIENERNSHTIYPPENQVFSWSFHCDIDNVK
VIILGQDPYHGPRQANGLAFSVERNVAKPPSLINIFKEIKNEYPEFQIPSHGDLKQWSNQ
GVLLLNASLTVRSNQPNSHSNHGWEQFTDSIIRYLNQHYSNRVFLLWGSYAHKKGSFIDS
KKHLVLKSVHPSPLSAMRGFFGCNHFKQCNDYLQKHNIKPIDWTKLD

BLAST