GenomeNet

>dre:567794 K00710 polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41] | (RefSeq) galnt17; putative polypeptide N-acetylgalactosaminyltransferase-like protein 3 (A)
MMRFTGFRTPKSFMAFVMRRWKILLVLNVFTVAGFITFWGKCNVRTTKGVGQQMAVDSRG
QTNLNGSVQETSITHDVLLKRLGSLEDVVYRQLNGLSKSLGLIEGFGGRGRGGIPATLTP
AEEKEAKFLREKYGYNAFLSDKISLDRSLPDYRPSKCKKAFFPRDLPQISIIFIFVNEAL
SVILRSVHSAVNHTPAHLLKEIILVDDNSDDVQLKGPLEEYVNKRYPGLIKIVRNQKREG
LIRARIEGWKVATGEVTGFFDAHVEFTPAWAEPVLSRIKENHKRIILPSIDNIKDETFEL
ERYENSGHGYNWELWCMYISPPKQWWDEGDTSAPIRTPAMIGCSFVVNREYFGDLGLLDA
GMDVYGGENIELGIRVWLCGGSMEVLPCSRVAHIARTKKPYHSNIAFHTRRNALRVAEVW
MDQYKSNVYLAWNLPMKNHGIDYGDVSERLALRKRLQCKSFDWYLDNIYPEMRRYNNTVF
YGEIRNTNVTHLCVDQGIKENHTATLHPCHGWGPQLGRYTKEGYLFLGPLGSTGEDTRCV
VDDKISSYPQLLNCEKVSSVRQKTWHFAQNESIISRATGRCLEVVPANVYFGYALILRSC
TGQKWNIKNLMKQDQGQ

BLAST