GenomeNet

>dre:797549 K00710 polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41] | (RefSeq) galnt9; polypeptide N-acetylgalactosaminyltransferase 9 (A)
MAVARKIKTLLTVNILVFVGIILFSVYCRIQDRSEELVQIGRLSDQRLRGRNAKVTNSMD
RQSILKRLERLEDVVYNQLNGLAKPMGLVEGPGGLGQGGAAATLGEDSRETEGRFEEYGY
NAQLSDRISLDRNIPDYRPKKCKQLTYSDDLPQISVVFIFVNEALSVILRSVHSMVNHTP
AHLLKEIILVDDNSDSVELKFNLDHYVNKRYPGLVKIVRNSKREGLIRARIHGWNAATAP
VVGFFDAHVEFNTAWAEPILTRVKEDHTRIILPAIDNIKYNTFEVQQYANAAHGYNWGLW
CMYIIPPQDWLDRGDETAPIRTPAMIGCSFVVDREYFGEIGLLDPGMEVYGGENIELGMR
VWQCGGSMEVLPCARVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDEFKSHVYMAWNIP
MNNPGVDFGDVSERVALRKKMNCKSFRWYLEHVYPEMRIYNNTITYGEVRNSKASGYCLD
QGSEEDERAILYPCHGMSSQLARYTTEGLLQLGPLGSTTFLPDTKCLVDDGRGRTPSLKK
CDSVTRSSQRLWDFTQNGPIISRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNWIK
HPRH

BLAST