GenomeNet

>dzc:W909_13690 K01782 3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3] | (GenBank) fadJ; fatty-acid oxidation protein subunit alpha (A)
MTEQLGMDQTDERGTQAAFQLTFRPDHIGVITVDVPGEKVNTLKAEFAEQMQTVLSQARQ
YNGLQGLIILSGKPASFIAGADIGMLDACADVASAQKLAETGQHALDAIAHLPFPVVAAI
HGTCLGGGLELALACDYRLCTADDSTRLGLPEVQLGLLPGAGGTQRLPRLIGVDRALELI
LTGRQLRAAQARRIGLVDEVVAPAVLLEAALGFIRRGKRPVTSPGWRHRLLMLPYVRRWL
FERVRRQTLAKTQGNYPAATRIIEVVRRGLEQGSQVGYQGEARAFGQLVVSPESVALRRL
FFTTTALKKDFGAPVAPGPLRRVGVLGGGLMGGGIASVTALNGQLPVRIKDIQEQGITQA
LHSSWQRLSKQVARRRITPAEQRRQMSLLSGGTDYRGFEHVDVVVEAVFEDIALKQQMVR
DIEAVTPPHTVFATNTSSLPIHQIAAGASRPEQVIGLHYFSPVDKMPLVEVIPHAGTDNS
TLATTVALARKQGKTAIVVADKAGFYVNRILAPYLNEAARCLLEGEPVESIDRALVRFGF
PVGPFTLLDEVGIDVAMKIVPVLVTELGERFCAPAALEAIARDNRKGRKNGRGFYRYDLS
RYERLCNWWRRQHKVSDSRIYRLLDVTPTAHLDPALMTQRCVMMMLNEAVRCLDEGVIRR
PGEGDIGAVMGIGFPPFLGGPFHYMNQLGITTVVGTLRSLQKQYGDRFAPAEGLLRRQSE
QTGFIDDTMS

BLAST