GenomeNet

>eai:106846020 K19523 carnitine O-palmitoyltransferase 1, muscle isoform [EC:2.3.1.21] | (RefSeq) CPT1B; carnitine palmitoyltransferase 1B (A)
MAEAHQAVAFQFTVTPDGVDFQLSREALKHVYLSGINSWKKRLIRIKNGILRGVYPGSPT
SWLVVIMATVGSSYCNVDISMGLVSHIQRCLPEGCGPYQTPQTRALLSMAIFSTGVWMTG
IFFFRQTLKLLLSYHGWMFEMHGQTSHFTKVWAICVRLLSSRRPMLYSFQTSLPKLPVPS
VPATIQRYLESVRPLLDNEEYYRMEMLAKEFQDKTAPRLQKYLVLKSWWATNYVSDWWEE
YIYLRGRTPLVVNSNYYVMDFVLIKNTDVQAARLGNIVHAMIMYRRKLDREEIKPVMALG
MVPMCSYQMERMFNTTRIPGKKTDVLQHLSDSRHVAVYHKGRFFKVWLYEGSRLLKPRDL
EIQFQRILDDPSLPQPGEERLAALTAGGRVEWAQARQAFFGSGKNKASLDAIERAAFFVA
LDEESHHYDPEDEASLSLYGKALLHGNCYNRWFDKSFTLISFKNGHVGLNTEHAWADAPI
IGHLWEFVLGTDTFHLGYTEAGHCIGKSNSMLAPPQRLQWDIPDQCQAVIESSYQVAKAL
ADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDRGRFCLTYEASMTRMFREG
RTETVRSCTSESTAFVQAMVEGTHMKAHLQNLFRKASEKHQNMYRLAMTGAGIDRHLFCL
YVVSKYLGVSSPFLAEVLSEPWRLSTSQIAQFQIRMFDPDQYPNHLGPGGGFGPVADDGY
GVSYMIAGENTIFFHVSSKFSSSETMADSDPGERNYDNMLKMLSDLNKDLEKLLEEMEKI
SVQATWMAYDMVVMRTNPTLAESMRRLEDAFLNCKEEMEKNWQELLSETTRKQ

BLAST