GenomeNet

>ecln:ECNIH4_16070 K00240 succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4] | (GenBank) sdhB; succinate dehydrogenase (A)
MKLEFSVYRYNPDVDDAPRMQDYTLEAEEGRDMMLLDALIQLKEKDPTLSFRRSCREGVC
GSDGVNMNGKNGLACITPISALQRPGQKIVIRPLPGLPVVRDLVVDMGQFYAQYEKIKPY
LLNNGQNPPAREHLQSPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETESRLEGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA

BLAST