GenomeNet

>eee:113582065 K00799 glutathione S-transferase [EC:2.5.1.18] | (RefSeq) gsto1; glutathione S-transferase omega-1 isoform X1 (A)
MASTQKCYGKGTCVPGPVPNGQIRIYSMRFCPFAQRTRLVLSAKGVKHETVNINLKDKPE
WFLAKNPLGLVPTLETPFGQVIYESPITCEYLDEVYPEKKLFPSDPFEKAQQKMLLEEYS
KVIPLFYKIPGSRKNGEDVSALEAEFKEKLSKLNEVLVKKKTSFFGGNSVTMIDYLIWPW
FERLEAWQLNHCLDGFLELKKWVSCMLEDPAVKDIIHNTDTHKAFFNSYLDGNPNYDYGL

BLAST