GenomeNet

>efd:EFD32_1545 K06167 phosphoribosyl 1,2-cyclic phosphate phosphodiesterase [EC:3.1.4.55] | (GenBank) lactamase_B super family protein (A)
MKINYLGTGAAERIPGIFCNCKLCKYAREKKGREIRTQTQLIIDDILLIDFPGDSYLHLL
QYDLCFADFNSLLISHWHSDHFYGEDLAYRMSGYALDIPNRLTVYGNEAVKTFYQRAFDL
EGRQDDTRLHYQVIQPYKCFTIANYTIYPLPAQHGNFSEDCFIFVIDDGKDAFLSTHDTG
YFTSEMFEYLEKSHLLLSIVSLDCTSQTNETGNSHMNWEENLKLIAELKERKLVTDKTIY
VANHFSHNGGLSYAEMAALSQKHEIITSYDGLEILT

BLAST