GenomeNet

>efm:M7W_1262 K02433 aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7] | (GenBank) Aspartyl-/Glutamyl-tRNA(Asn, Gln) amidotransferase subunit A (A)
MTELHNRSLEELHHMLVSKEITVQDLTKATFERIKETEPEVEAFITLNEEKALEQAKALD
EKGIDESNVLAGIPIGIKDNIVTKDILTTAASKILYNFEPIYDATVMDKIYQADMIPVGK
LNMDEFAMGGSTETSYFKKTKNAWDPTKVPGGSSGGSAAAVAAGQIPVSLGSDTGGSIRQ
PAAFNGIVGMKPTYGRVSRFGLIAFASSLDQIGPMTRTVKDNALALTAISGYDEKDGTSS
GVSVPNFAEGLTGDIKGMKIALPKEYLGEGVAPGVKEAVLKAAETFRSLGAVVEEVSLPH
SKYGVAVYYIIASSEASSNLQRFDGIRYGYRSENVKSLDDVYVNSRSEGFGEEVKRRIML
GTFSLSAGYYDAYFKKAGQVRTLIKRDFEKVFADYDLIIGPSSPTVAFGIGENINDPITM
YMSDILTIPVNLAGLPGMSVPAGLSEGLPVGLQIIGNYFDEKTMYQAAYAFEQATEFHTQ
QPAILGGKDE

BLAST