GenomeNet

>emr:EMUR_00940 K00242 succinate dehydrogenase / fumarate reductase, membrane anchor subunit | (GenBank) succinate dehydrogenase (A)
MVSHSVYHWLFQRITACILLPLSLWFLFKFLGVISLILKSFPECRLSISDVSSTDLIVLL
CFFIFAFYHAVLGMQVILEDYIHSVVLRASVFLVIKGIVVLTTLFLAFIILYNVFLKY

BLAST