GenomeNet

>eus:EUTSA_v10020704mg K10801 methyl-CpG-binding domain protein 4 [EC:3.2.2.-] | (RefSeq) hypothetical protein (A)
MVPPVIYKYRRRRYRRLGRDDDGSLMRTPRVSLYHSNDRFNSNTIEVSDNSRSSGSFSED
GARIRNLGCVHSETETRHGSCSLVLQCRNLDDLFAGFAYKGVRKTRNVFGSKPKSTLDDD
DTVKEQDFDDDSVFESHSERQVCSEFQTQVRKVSPYFQGSTVSQQPKDGCDSDCVSSQNG
RNYRKECRKVQAKVRRVSPYFQASTFSQCDSESVASQSGRKYRKESSKLQAKVPRVSPYF
QGSTVSEQPNPSRDLRQYFKVVKVSRYFHDMPADGTQVNEPQKERSRRMRKTPVVSPSLS
QCQKTDEAYLRKMPDNTWVPPRSPCNLLQEDHWHDPWRVLVICMLLNKTSGAQTRGVISD
LFVLCPDAKSATEVEEKEIESLIKPLGLQKKRAKMIQRFSLEYLQESWTHVTQLYGVGKY
AADAYAIFCNGKWDCVRPADHMLNYYWEFLRIRYRL

BLAST