GenomeNet

>fca:101088150 K05292 GPI-anchor transamidase subunit T | (RefSeq) PIGT; GPI transamidase component PIG-T isoform X2 (A)
MAAALPLVLLVLLLLGPVGRGHAEPPRDSLREELVITPLPSGDVAATFQFRTRWDSELQR
EEVSHYRLFPKALGQLISKYSLRELHLSFTQGFWRTRYWGPPFLQAPSGAELWVWFQDTV
TDVDKSWKELSNVLSGIFCASLNFIDSTNTVTPTASFKPLGLANGTDHNFLRYAVLPREV
VCTENLTPWKKLLPCSSKAGLSVLLKADRLFHTSYHSQAVHIRPVCRNARCTSVSWELRQ
TLSVVFDAFVTGQGKKDWSLFRMFSRTLTEPCPLASESRVYVDITGYNQDNETLEVTPPP
TTTYQDVILGARKTYAVYDLLDTAVINNSRNLNLQLKWKSPPESEAPPVPFLHAQRYVSG
YGLQNGKLNTLLYNTHPHRAFPVLLLDTVPWHLRLYVHTLTITSKGKDNKPSYVHYQPAQ
DRLQPHLLEMLIQLPANSATKVSIQFERALLKWTEYTPDPNHGFYVSPSVISALVPSTVA
AKPVDWEESPLFKSLYPVSDSSSYFVRLYTEPLLVNLPTPDFSMPYNVICLTCTVVAVCY
GSFYNLLTRTFHIEEPSTGGLAKRLANLIRRARGVPPL

BLAST