GenomeNet

>fis:FIS3754_38240 K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] | (GenBank) dehydrogenase catalytic domain-containing protein (A)
MSIYEVFMPALSSTMTEGKIVSWEKSPGDKVEKGETVVVVESDKADMDVESFYEGYLAHI
IVQAGETAPVGAAIALLAETEAEIETAKSQAQGAGTAKQETTATAAPTKTADTAASEKPA
LATHNGSNHRSGRVVASPRARKLAKELKVDLSNISGSGPYGRIVAEDVQAVIGKTSQPPA
SAAPITPAPVVTPVATTPAVAAVPGQVVPLNTLQSAVARNMVASLSVPVIHVGYTITTDA
LDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLINANYSDQGIVYPASINVAVAVAMDDGG
LITPVLQNADQLDIYSLSRTWKSLVERARVKKLQPEEYSTGTFTLSNLGMFGVDRFDAIL
PPGQGSILAIGASRPQVVATADGMFGIKQQMQVNMTSDHRIIYGAHAAAFLQDLAKLIET
NPQSLTM

BLAST