GenomeNet

>fox:FOXG_01544 K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] | (RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial (A)
MMASSMAMRRLAVGPAFTRAARFPSRAFSTTRPVARVITGNGPLRAKEASPFVSNKYAVI
DHEYDALVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDD
WRWHMYDTVKGSDWLGDQDAIHYMTREAPASIIELENYGCPFSRTEDGKIYQRAFGGQSK
QYGKGGQAYRCCAAADRTGHALLHTLYGQSLRHKTNYFIEYFALDLIMQDGECRGVLAYN
QEDGTLHRFLANHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPT
GIYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVG
AEKDHIYLQLSHLPAEILAERLPGISETAGIFAGVDVRKQPIPVLPTVHYNMGGIPTRYT
GEVLTVDEKGEDKVVPGLYACGEAACVSVHGANRLGANSLLDLVVFGRAVSHTIRDKFNP
GDALKPVAADAASDHIEVLDKVRTADGPKSTAEIRLAMQKAMQTDVSVFRTQESLDEGVR
KMKEIDGMYSQVGMKDRSMIWNSDLVETLELRNLLTCAIQTATSAANRKESRGAHAREDF
PERDDENWMKHTLSFQKEPHGKVDLAYRKVIANTLDEAECKPVPPFKRVY

BLAST