GenomeNet

>gbs:GbCGDNIH4_0552 K02358 elongation factor Tu | (GenBank) Protein translation elongation factor Tu (EF-TU) (A)
MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKVLAETGGATFTAYDQIDKAPEERARG
ITISTAHVEYETGNRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKVDMVDDPELLDLVEMEVRELLSSYQFPGDDIPIIKGSALCALE
DKNPEIGRDAILKLMEAVDAYIPQPERPLDRPFLMPIEDVFSISGRGTVVTGRIERGEVK
VGDEVEIVGLKATSKTTVTGVEMFRKLLDRGEAGDNIGALLRGTKREDVERGQVLAKPGS
ITPHTKFAAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVSLPEGTEMVMPGDNVS
MQVELIAPIAMDEGLRFAIREGGRTVGAGVVAKISQ

BLAST