GenomeNet

>geq:CG018_03755 no KO assigned | (GenBank) hypothetical protein (A)
MKRLRLLFYFTTIGIALGYFFAVLLSFFVQYAMLADESLIMYVWTLYGIMTGFVFKKIGN
KYGFFIIEGLVLIMMLIAGRMNILFYITKEALGLTSVKQIHTPLLVIIVLINIINFYIVY
TRSKYQKVYSREELKKIKEEEVKLSDLREVNPEEEAKRKKQRRNARIITIVAFALFFAIY
FTVPSFKSGINTAFATLSQFDTNAVIEYLRSWGAWAAVVSFILMILQSIAAPIPAFLITL
SNAAIFGWVIGAVLSWSSAMAGAAVCFYIARGLGRDVVEKLTSKGAMASIDVFFERYGDR
AILICRLLPFVSFDFVSYAAGLTNMGFWKFFIATGIGQLPATIIYSYVGGTLSGGARNLF
IGLMCLFALSIVIGIMKKIYNDKHKKEEEKQKTGEMVK

BLAST