GenomeNet

>gga:769701 K16573 gamma-tubulin complex component 6 | (RefSeq) TUBGCP6; LOW QUALITY PROTEIN: gamma-tubulin complex component 6 (A)
MESITQLFNDLCEAHLTGLPWKVHLGRQKISKRKAKQNLKRVAYNTLFINLFQDEARKLQ
SNISRLPVKNKILMLSFNLRVGGLGAQADRLESLVEELEQAEGLPFTEVNAVLDLLVQLA
GTGPPQLVPQKKDYFLNNKYVGRNVKYQGYDYYDVSVFEADIQSLITNEECQFNDTIQKT
LQIMEAAPGTGLPAIGLFSQNYPAGDKFERETRVSLFGALVHSRTYDMDIKLDLPPVPDN
ADLSGLAIKVPQSIDQSEDEGFQSASNLTPDSQSEPSMTPDIDLWDAVLTYGPSKRRCWE
RIGYPPGKKEEPYLTEAGREAFDKFYKLREGEMQLFSSTALQLPQLVLMREPELVKDVLN
VLIGVVSTTFSLNQAAQTFIIKEGVYVSGTSPETMHNLLSEVAEYGTYYTRLSRFSLQPV
LDSSYSKGLVFQAFTSGLRKYLQYYRACVLSTPPTLSLLTISFLFRKLGRQLRYLAELCG
IGITALGISGGAGASFPTGVKLLSYLYKEALNNCSNEHYPVLLSLLKTSCEPYTRFIYDW
VYSGVFRDVYGEFMIQVNEDYLCFRDKHYWTHGYVLISKEVEDCVPVFLKHIANDVYICG
KTINLLKLCCPRHYICWSDIPVPRISVIFSLEELKEIERDCAVYVGRMERIARYSSISKE
EKDLRMEIAKQELIVHARETASKVLQAINDRQKSERLALDAKKREQFQKLKEQFAKDQER
RLAXKQEEIDDDFSYARELREREKRLKALEEELEKKARQELIDHYSKLSDDAARREQRAL
WKIQRHKLETARLKFLFEDQKRIEEMLEKLPDGSYRRKLDIIPYNSASWLWIETLLWKIH
IHRFAVSSVKPLRSNEKVGRKESESGLENITSTDKPLAMPQLANTNADQLCQPKTAGSEC
SLQSSEQVCSPLCNADSSPESSVNIEDFLPKPQDEQPVAISLQGSLLDEALRNINSDLSE
TSPMSENQPVSEEGNTLLHQQNEYDFNTVLRPTAALQGHIRVGENVFDVEPRRPRWNIHG
HASDASIRVGEYVPEVDTYQPRSSPYGHSSDSHIEISSYTSEVESTRPRWNIHGHASEAH
IKIGEYASEVEPSRPRWSIHGHASEANIRVGEYVSNVAPARPRWNIHGHVSDANIKIGEN
VSEVVSARPRWNIHGHSSQSHIKIGELVSDTQPVKSRWSPFGHASHSSIQIGKWTPSTED
DPIPHRKAISGPSSDSTVQTLLYNEELSPSEEIRKETKPSQAKESISPQSQPSDIDPVSP
DTRDDKKENTTKRSKKVSVIAVFNLFVIVVIAGEVDKDPSPDSSQSLQAKEPEKAIPQDT
VPQEALFSEPSASKTKDEEGGEEDAWKKEQAYLKALSDQYCIEKYQDSYDLMSELPVSHL
LHHVIPRSYTFPVDPMVQSATDETAVQLSELLSLPVLMKRSITAPLVSHVSLVNKAIVDY
YFVELNVEKHFEALRHFLLMEDGEFAQSLSDLLFEKLGSGQTPGELLNPLVLNSILNKAL
QYSLHGDTQLASNLSFALKYLPEVFKPNAPDALSCLELRYKVDWPLNIVITESCMNKYNK
IFSFLLQLKHMVWTLKDVWFHLKRTALVSHASNSVQFRQLQLYKHEMQHFVKVIQGYIAN
QILHVTWCEFGNKLSSVGNLEEIHRTHAEYLNKAIFRGLLTEKAAPVMNIIHSIFSLILK
FRSQLISQSWSFDAGKQMAVHPNFGLMQQSYNTFKYYSHFLFKVVTKLVNRGYQPHLEDF
LLRINFNNYYKDN

BLAST