GenomeNet

>hai:109380308 K01283 peptidyl-dipeptidase A [EC:3.4.15.1] | (RefSeq) ACE; angiotensin I converting enzyme (A)
MGAVSGRPELGPRPRLLSLPLPLPLLLLLLLLPPSPPSALALDPTLQPEEFSADEAGAQL
FVKSFNPKAEQVLYQSTVASWAHDTNITEENARRQEEAALLNQEFAEVWGQKAKELYDPI
WQNFTDPVLRRVLSGVRILGPANLPLVKRQQYNSLLSSMNRIYSTAKVCYPNRNDTCWSL
DPELMHILSDSRNYALLLYAWEGWHNAVGIPLKPLYENFTVLSNEAHEQDGFSDTGEYWR
SWYESSTFVEDLEKIYHQLEPLYLNLHAYVRRALHRRYGDRYINLRGPIPAHLLGDMWAQ
SWENIYDMVVPFPDKPNLDVTSTMVQKGWNATHMFRVAEEFFTSLGLLPMPPEFWAESML
EKPNDGREVVCHASAWDFYNRKDFRIKQCTRVAMDQLSTVHHEMGHVQYYLQYKEQPVSL
RQGANPGFHEAIGDVLALSVSTPSHLYKIGLLDHVVNDTESDINYLLKMALEKIAFLPFG
YLVDQWRWGVFSGRTRPSRYNFDWWYLRTKYQGVCSPIARNETHFDAGAKFHVPHVTPYI
RYFVSFVLQFQFHQALCKEAGHQGPLHQCDIYQSTKAGDKLRTVLQAGSSRPWQEVLKDM
IGSDTLDAEPLLNYFQPVRQWLEEQNQRNGEVLGWPEYQWQPPMPDNYPEDIVLVTDEAE
ASKFVEEYDQKSQVVWNEYAEANWNYNTNITTEASKILLQKNIQMANHTLKYGTRARRFD
ITYFQNTTMKRMIHKIQDLERAALPVEELEEYNQILLDMETTYSVASVCHSNGTCLQLEP
DLTNLMATSRKYEDLLWAWKSWRDQVGRSILPFFPKYVELSNKAARLNGYEDAGQSWRST
YEMPTLERDLEQLFQELQPLYLNLHAYVRRALHRHYGPQHINLEGPIPAHLLGNMWAQTW
SNIYDLVVPFPSVPKMDATEAMIKQGWTPKRMFKEADNFFTSLGLLPVPPEFWSKSMLEK
PTDGREVVCHASAWDFYNGKDFRIKQCTTVNMEDLVVVHHEMGHIQYFMQYKDLPVTFRE
GANPGFHEAIGDVLALSVSTPKHLHSINLLSSNDDSYEQDINFLMKIALDKIAFIPFSYL
IDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVARSQGDFDPGAKFHIPSSVPYIRY
FVSFIIQFQFHEALCQAAGHEGSLHKCDIYKSKEAGKLLADAMKLGFSKPWPEAMKLITG
QPNMSASAMMKYFKPLLDWLLIENERHGEKLGWPQYNWTPDSARSEGSFPGNGHVNFLGL
NLEEQQARVGQWVLLFLGVVLLVATLGLAQRLFSLRHRNRHRPHHGPQFGSEVELRHS

BLAST