GenomeNet

>hhi:HAH_1276 K05308 gluconate/galactonate dehydratase [EC:4.2.1.140] | (GenBank) mandelate racemase/muconate lactonizing family protein (A)
MGKANDVDYADLHDPNAEYTMRELSAETMGVTAKRGGGRDVEITDVQTTMVDGNFPWTLV
RIYTDAGIVGTGEAYWGAGVPELIERMKPFVVGENPLDIDRLYEHLIQKMSGEGSVEGVT
VTAIAGIEVALHDLAGKILEVPAYQLLGGKYRDEMRVYCDCHTEEEADADACAEEARRVV
DELGYDALKFDLDVPSGLEKDRANRHLRPGEIRHKAEIVEKVTEEVKDEADVAFDCHWTF
SGSSGKRLADAIEEYDVWWLEDPVPPENLEVQEEVTKSTTTPITVGENRYRVTEERRLIE
NQAVDMIAPDMPKVGGMRETRKVADVANQYYIPVAMHNVSSPIATMASAHVGASVPNSLA
VEYHSYELGWWEDLVEETVIEDGYIEIPEEPGLGLTLDLDAVEEHVVEGDTVFDEA

BLAST