GenomeNet

>hpse:HPF_05295 K00029 malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40] | (GenBank) maeB1; NADP-dependent malic enzyme (A)
MTPAEQALRDAALEYHRSPNKGKIAVVPTKPLSNQRDLSLAYSPGVAFPCLAIEAEPALA
SEYTSRGNLVGVITNGTAVLGLGDIGPLASKPVMEGKGCLFKKFAGIDVFDIELAERDPD
KLVDIIAALEPTLGGVNLEDIKAPECFYIERKLRDRMKIPVFHDDQHGTAIISSAALING
LELVKKDIGAVKVAVSGAGAAAIACLDLMVNLGVNIENILVCDSKGVIQTERDDAKAGKL
DESKQRYCRTSSARTLADAMNGADVFLGCSAAGVVDADMVKSMARQPIILALANPEPEIR
PEVAKAARPDCIIATGRSDYPNQVNNVLCFPYIFRGALDCGATKITEEMKMACVRQIADL
TKAETSDEVAAAYAGQDLVFGPDYIIPKAFDTRLILKIAPAVAQAAADSGVATRPITDMD
AYRQSLSRFVTQTGILMRPIFNAAKALPANKKRVAYADGEDERALRAAQMAIDDGLATPI
LIGRPAVIEARIQKAGLRIRLGVDVENVNPEGDPRFRQYWEHYHGLMKRNGATPEVAKAA
VRRSNTIIGSLMLSLGDADALICGLVGTYATHLERIDAILGKAPGVNNYAAVNALMTASG
PLFIADTYVNEDPAAEQLAEIAWMAAQQVQRFGLPPKVAFLSHSSFGSSKRASAKKMRAA
RDLFVAQHPGIECDGELHGDAALQPEIRQAYLGDSTLSGSANLLVCPNVDAANILYNVLK
TTASGGVTVGPVLTGVARPAYILTPAATVRRVLNMTALAAAASPRG

BLAST