GenomeNet

>hsa:259197 K06743 natural cytotoxicity triggering receptor 3 | (RefSeq) NCR3, 1C7, CD337, LY117, MALS, NKp30; natural cytotoxicity triggering receptor 3 (A)
MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEV
VPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTG
NGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVV
PAPLPPPCGSSAHLLPPVPGG

BLAST