GenomeNet

>hsa:3806 K07982 killer cell immunoglobulin-like receptor 2DS | (RefSeq) KIR2DS1, CD158H, CD158a, p50.1; killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 1 (A)
MSLTVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLL
HREGMFNDTLRLIGEHHDGVSKANFSISRMKQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
VIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGT
FQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGN
PRHLHVLIGTSVVKIPFTILLFFLLHRWCSDKKNAAVMDQEPAGNRTVNSEDSDEQDHQE
VSYA

BLAST