GenomeNet

>hsa:9436 K06742 natural cytotoxicity triggering receptor 2 | (RefSeq) NCR2, CD336, LY95, NK-p44, NKP44, dJ149M18.1; natural cytotoxicity triggering receptor 2 (A)
MAWRALHPLLLLLLLFPGSQAQSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASA
LVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVS
KSVRFYLVVSPASASTQTSWTPRDLVSSQTQTQSCVPPTAGARQAPESPSTIPVPSQPQN
STLRPGPAAPIALVPVFCGLLVAKSLVLSALLVWWGDIWWKTMMELRSLDTQKATCHLQQ
VTDLPWTSVSSPVEREILYHTVARTKISDDDDEHTL

BLAST