GenomeNet

>hsa:962 K06479 CD48 antigen | (RefSeq) CD48, BCM1, BLAST, BLAST1, MEM-102, SLAMF2, hCD48, mCD48; CD48 molecule (A)
MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFY
TFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQE
WKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSV
LETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSFGVEWIASWLVVTVPTILGL
LLT

BLAST