GenomeNet

>ica:Intca_0081 no KO assigned | (GenBank) hypothetical protein (A)
MAQPGREVPWFSGFGPPGRLSPGNRAMAYAAGPEVSAAIPEQSDRPPRIVDEVGVGSSRT
KRAAGGAGGVAVLLCSVLTAPALAADTSPVPRPSPGAPVASQGVADPVAPVPPVAPIDPL
GSGAGESLLRLYDVVKVTAGYVAATRLEPGGGSSRPGRDSAWQPPADLQTPPVTPGTAAG
PGRRMTKYDVLGAAYQKAADALADSCQLPFAVLMAIGEVESGSLRGRTLDVRHNVVPPII
GPALSGSGFAAIRDSDRGRLDGDPVWDRAVGPMQFIPGTWRLWGADGNGDGVADPQNVED
AALSAGRYLCAGGRDLARQADLERAILSYNHSRRYLETVLDLYDSVMGGAVAGP

BLAST