GenomeNet

>ica:Intca_2499 K21687 resuscitation-promoting factor RpfA | (GenBank) Peptidoglycan-binding lysin domain (A)
MAGSHGPPTTDEVLGAGLLWGAVALCGWLGITFAILALSAAPGALGRTFCRIADSLTPHC
ARQALALALGASVGTVALPAPAAIAATTAATTAGPTAAGPATSLSTSTSGSPSTGTSGSA
ADSSSGAASALAPAAAGSGVPGPGFAPSHPAHGAVSRTTPAPAPGWVPDRPARVTSPGPG
SLLGGTLRPAGSTIDTVTVRRGDTLWSIAARHLGSGASDSEVAAEWPLWFAANRGVIGDD
PDVVLPGQLLRAPTAEVAP

BLAST