GenomeNet

>ica:Intca_2653 K12132 eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1] | (GenBank) serine/threonine protein kinase (A)
MNQPDVLIAGRYRLLNRVGVGGMGSVWEARDERLQRTVAAKLLHLPPGASAADAENAKNR
AMREARNTARLHHAHAVPVFDVVEHEGQPCLIMQYLPSRTLQQVLDENGPLPPDDVALIG
AEVGSALAAAHAAGIVHRDVKPANVLILDDGSAMITDFGISRALGDATLTAAGMVTGTPA
YLAPEVARGEESSPATDVFSLGATLYAAVEGTPPFGLDPNPMALLHRVASSAATPPTRAG
ALTPVLLAMLADRPSERPSMAAAVEALERVDLTGPAGADPTVAMPAAADPTVAMPVAGAT
QPLRTVPPALPLPGARVAAAGAAVGAGAGASSASGGVTSPRPAADRARVTGTGDPGGSGR
RRSRRGVLVALAVVALVAVGLLAWQALTAGDGRTPSAAPPETTSASSPSTTPSPRTTTSP
RPTTTSAAPTTQSETPPSAPAAPSAAKLSKAVREYYSLLPDDTEEGYALLTERYRSTTAG
SVDTYESFWDSIKKVTVKDVDGSPPGTVEATLTYVFKDGRVFVERTAYGLVEEDGVLKID
SSEVLSSREV

BLAST