GenomeNet

>ica:Intca_2688 no KO assigned | (GenBank) hypothetical protein (A)
MDFGGRNETGRDDTTDAPRAGSRRIGPYEASLVDNRERVQQAVKRQQQRRRQVRISVAAA
GAVALVAAGGVGLQLLRDGTPTQLAAPGVVPEAPTSQRVASGCKRPANLTVAVPSAMAPA
FAEVVEAFNAQPGVPCASFTVVPLEASTVAQSLAGPTRPDAWVLDADLWLEQANSRAGLG
LVADEPFAASPVVLAMTGPAADEAEGSGWPQVVAPAEEDLRLVLPDPATSTVGLLSLAAS
AAHLPQSREAGESALRQVAETSGSVPVAASALVAASDPGRNVTTPVSLSELARYNAANPR
SPLTGVAPAEGSPVLEYSLVAVADGTVASRVLRSLRDFLASDEARAVVTTHGFTAPGQPA
AAPAQPGAAPGQPAAAPAQPAAAPSTAATPVRGTVQPLPAPSLAATEKLRDTWAALQPAP
HGILALDTSATTLTRLDGETILDHITRGAQIGLAALSDRSKVGVWLYGQHLGPKGEDHRV
VVAPGALSGAGQLQAIAQGLESLPSVAGGGRGLYDTVIAAVDAARTGGQPGRANTAVVVT
AGPNDDDFGASLGAVKAALRRSSTEPAVRLVIIGVGPKPDAKLLTEVAASAGGTYTAVQQ
AGDLAPAITAALNGGQ

BLAST