GenomeNet

>ksc:CD178_01130 K23993 multiphosphoryl transfer protein [EC:2.7.3.9 2.7.1.202] | (GenBank) ptsI; Phosphoenolpyruvate-protein phosphotransferase (A)
MKTTERRPARRGRPGEIRLEGQPVSPGVAIGYAAIAHEPAPPPVDMARRDCDPAHERTRL
HDAISRSVAQLGRLHDRLALLPEDGQVEIGSLLEVYRRMLGPSRLRRGIEGRLDQGMVAE
AAVMQETEALAGFMLAPPGRVAPEGEDAVAARRRAGEFREIGRRLIRNLSGTPYRSFSAL
PDGAILVAEQLRPADAALIDPSRIAAVVTEEGGSTGHTAILLRALGIPAVLAAHGLLAQL
GRRTRLVVDGTTGQVIVRPSTRTAAAARVDVAAYARERQMLGRLRRLPARLSSGEVVTLQ
ANLEIPAELPMIAQSGAGGIGLLRSEFLFMNAETLPDELHQEAVYLPLIEAMAGDPVTIR
VVDWGSEKNSDALSRAGIGESGDTNPALGVRGIRLLLQHRGLLETQFAAILRAARAGPVR
VMLPLVSSVGELRAARDIYARIGRRLRRKGVEIPDPLPPLGIMIETPAAALMADVLAQEA
EFLAIGTNDLTMYTLAADRAATDVAALYDPFHPAVLQLVRMTADAALRHRRPVSLCGEMA
SDPIAVPLLVGLGIRSFSMHASAVPRVKRAIRALAMDDCRRMACRALEAADGREVSTMLM
DYAAAARQPADE

BLAST