GenomeNet

>laf:SD55_0766 no KO assigned | (GenBank) histidine kinase (A)
MKLIYQNMLGFLLIIVTTISIIGYSEIGYARDQAYMQNYQRMEGYANSLGNLAAAEGKDD
TAILSNSFLNQLEFILRGDDVHLRIFNEKNEQIYPKTREKIQLSKNIFATLKNGQEIRIQ
NNHNENAPIASTKDAYTGVLVPWMNGKNLIGVAWISSRVKHVERPIYMAKRNLLRALLTT
VAVGLILSFIISYYSTKRIKRLSRATQKVASGNFNVQIKHKDSDEIDQLAENFNQMVLAL
KRSNEEVKAQENRRDQFMADAAHEMRTPLTTINGILEGLQYDAIPEESKPKSIALMQRET
KRLIRLVNENLDYEKIRNNQINLIKTNFNATPVLLDLKSQLMQNAKKAGDKLIFEVPTDL
PIYANRDRFTQVMVNLVQNAIQFTHDGKIKVSGKRLKHGAEFSVKDNGIGMSDDQIKYIF
ERFFKADPSRARMGTGESGLGLAIVSSLIKQHGGKITVDSKPGQGATFTVTFYDKGYEQF
IEK

BLAST