GenomeNet

>lav:100667696 K01283 peptidyl-dipeptidase A [EC:3.4.15.1] | (RefSeq) angiotensin-converting enzyme isoform X1 (A)
MGAVPGSPGPPPLLPLLLLLLRPPPATLALDPALQPGNFSTDEAGAQLFAQSFNSSAEQV
RFLNTVANWAYDTNITEENAQRQEETALISQDFDEAWGYKAKELYDNIWQNFTNPQLRRV
IRSIRILGPANLALAKRQQYNSLLSNMSRIYSTSKVCFPNKTATCWSLDPELTNILASSR
SYTMLLFAWEGWHDAVGIPLKPLYQDFTALSNEAYKQDGFSDTGDYWRSWYESPTFVEDL
EYLYHQLEPLYLNLHAYVRRALHRRYGDKFINLRGPIPAHLLGNMWAQSWENIYDMVVPF
PDKPNLDVTSTMVQKGWNTTHMFRVAEEFFTSLGLLPMPPEFWAHSMLEKPSDGREVVCH
ASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHVQYYLQYKDQPVSLREGANPGFHEAI
GDVLALSVSTPAHLHKIGLLDQVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRWGVFS
GRTPPSLYNFDWWYLRTKYQGICPPVVRNETHFDAGAKFHVPNMTPYIRYFVSFVLQFQF
HQALCKEAAHQGPLYQCDIYQSTQAGNKLRELLQAGSSRPWQELLKDMIGSDALDAQPLL
NYFQPVSQWLQEQNQRNGEVLGWPEYQWRPPLPDNYPEGIDLVTDEAEAQKFVEEYDKTA
QVVWNEYAEANWNYNTNITQEASKILLQKNMQLANHTLRYGTQAKQFDVTNFQNETTKRI
MKKVQDLDRAVLPTEELEQYNQILLDMETTYSMASVCHLNGTCLQLEPDLTKLLATSRNY
EELLWAWEAWRDKVGRAILPFFPKYVELSNKAAKLNGYKDTGDSWRAMYETPLLEHDLEL
LFQELQPLYLNLHAYVRRALHRHYGPERINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPS
APKMDATEAMIKQGWTPKRMFEEADNFFTSLGLLPVPPLFWNKSMLEKPTDGREVVCHAS
AWDFYNGKDFRIKQCTTVDMEDLVVAHHEMGHIQYFMQYKDLPLALREGANPGFHEAIGD
VLALSVSTPQHLYSINLLSSEGGGYEHDINFLMKMALDKVTFIPFSYLVDQWRWRVFDGS
INKENYNQEWWSLRLKYQGLCPPVSRSQGDFDPGAKFHIPSSVPYIRYFVSFVIQFQFHE
ALCQAAGHQGPLYKCDIYQSKEAGKRLADAMKLGFSKPWPEAMRLITGQPNMSATAMMNY
FKPLLXXXXXXXGREAKLAAPSPAYRPAHHPTLLASRPAHSEASFTGSGRVNFLGLELEA
HQARVGQWVLLFLGVALLVATLGLTQRLFSIRHQSLRHPHRGPQFGSEVELRHS

BLAST