GenomeNet

>lcf:108892807 K13646 lysyl hydroxylase/galactosyltransferase/glucosyltransferase [EC:1.14.11.4 2.4.1.50 2.4.1.66] | (RefSeq) procollagen-lysine,2-oxoglutarate 5-dioxygenase 3-like isoform X1 (A)
MSSCRLLCLLALAFLQSSVSAEQRRLSPENLLVITAATEETDGFKRFMRTTREFNYTVKV
LGLGEEWKGGDVARTVGGGQKVRWLKKELLKHSEKKDMVIMFVDSYDVIFASGPEELLAK
FSRLGHRVVFSAEGFCWPDQRLAPKYPVVHTGKRYLNSGGFIGFAPDLSAMVQQWKYKDN
DDDQLFYTKIYLDKTQRTKFNMTLDHRSRIFQNLNGAVDEVVLKFERAKVRARNVAYDTL
PVVIHGNGPTKLQLNYLGNYVPTAWTYEDGCGICDDDLLFFSDVPDEDMPLVYIAVFIEH
ATPFMEEFLDRLTTLNYPTARIRLFIHNNVVYHERHIQRFWERHRSLFPDALLVGPEENL
QEAKARTMAVEACKKDPDCDYYFSIDSDVALTNPDTLRILIEENKSVIAPMLSKHGKLWS
NFWGALSPEGYYSRSEDYIEIVQGKRIGLWNVPYITQTYLIKGSVLRSKLAQVSLYVDED
MDPDMVFCRSIRDQGVFMFVSNRDEFGRLVASTNFNTSRLHPDMWQIFDNPVDWREKYIH
ENYSRIFEDEKNLVEQPCPDVYWFPAFSDKMCDQLVETMEDYGQWSGGTNKDERLAGGYE
NVPTVDIHMNQIGFEKEWLKFLKEYIVPVTEKLYPGYYPKAQAIMNFVVRYRPDEQPSLR
PHHDSSTFTINIALNRKNVDYEGGGCRFLRYNCKVESPRKGWSFMHPGRLTHYHEGLPTT
RGTRYIMVSFVDP

BLAST