GenomeNet

>lfb:C1X05_12360 K12132 eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1] | (GenBank) hypothetical protein (A)
MYNKVVLFCYLLQYLFQECLQLIHKKGTARFHPRKVIAVEGKQLGGRYEILHLLGEGGMA
VVYKAKDHHLNRDVAIKIMNQKLHEGEPAIKRFIREAQTAGKFSHPNIVNVFDIGNEDDL
YYMVMELIEGPTLGDLIEERGPLPAKEAISIVMQICDGLAHAHKHGIIHRDIKPHNIMAT
ADGTYKITDFGISRLLSAATQYTKTGTVMGSVHYFSPEQACGQELNYSSDLYSLGIVLYE
LVTGDVPFDADQSVAIALKHLQHPVPDPRGKNQALPAALCDIIYKALAKKPEDRYQSAEE
FKQALQQALSAPTRALALPINRGESAEAQPPVSVTVVGAKPSKFFRFAMMGIIPLFLILG
FVYFNVSGEKALQKPQTGQVTPPEPKEQALQNVKPEATTWKEKTSGRKEQNKQTEVDEPA
PVQQNPDNDPVKEEPANEGPHGQEPGQEKPQLPQEPAPVTYEVIVDRFADQAQADECVKS
LNSKGIPAHYYEKNGDAGTVYVVSAGEFDDEELANARAEDVRNAGYPNTKVTKRS

BLAST