GenomeNet

>lio:JL53_09030 K01657 anthranilate synthase component I [EC:4.1.3.27] | (GenBank) anthranilate synthase subunit I (A)
MRKFKKMDADTLTAILAFQRLEGQGKSLLEGAAKDADAGRYSIIAVNPVHEIKVYQNDYY
LDGKHKKVADPLKEMETFIQKAKVNEIELPLDSGAIGYVGYDVIALYEELGTIPTENRDM
PDIRFYVYETFVIIDHQAEELILVQDNCYSGRSEAELEEALQQMEQQLITPKKREHDPVY
VAKMTYKSNYTKQEYIDLVQQAKKYIQEGDLFQVVLSQRLEADFTISPFDYYRKLRLLNP
SPYLYFIDFGDTVLIGSSPESLIKTKGQRVITNPIAGTRKRGATKQEDEQLSAELLADEK
ELAEHRMLVDLGRNDIGKIAVTGSVEVPVYLMIERYRFLMHLVSVVEGTLKPELTAIDAL
RSTLPAGTVSGAPKIRAMQRIYEWENVKRGPYAGAVGYLTKNGDSDFALSIRTMVVHAGK
AYVQAGAGIVYDSDPESEYLETLQKAKALLEVGE

BLAST