GenomeNet

>lmir:NCTC12852_00666 K03387 NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-] | (GenBank) ahpF; Alkyl hydroperoxide reductase subunit F (A)
MLDADLKNQLQTYLGHLKQPIELVATLDGSPKAKEMQELLQEIAELSDKITLREDPAADV
RKPSFAINRIGTDIGVRFAAIPLGHEFTSLVLALLHVGGHTIKLDADTIEQTKALSGDYD
FEIYMSLSCQNCPDVVQALNSMSVINPRIRVQTIDGALFQDEVEKRAIMAVPTVFLNGEV
LFQGRSSAEEILARLDSGAHSRAAEKLSEKDPFDVLIVGGGPAGAAAAVYAARKGIRTGV
VAERFGGQVLDTMSIENYISVLETDGPKFAAALEAHTRHYGVDIMNLQKVESISRDEAAG
MVTVKTASGASLKSKTVILATGARWRSMGVPGEQEYRNRGVTYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGVVDHVTLFEFMPELRADAVLQRKLESLPNVKILKNVQVTEVKASN
DKVSAIVYKDRTNDSIHEVALEGVFVQIGLVPNTDFLKDSGITLVRNGEIQVDVRGQTSM
EGVFAAGDCTTSPYKQIIIAAGDGAKAALAAFDHLIRTSAPK

BLAST