GenomeNet

>lum:CNR27_04510 K07258 serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4] | (GenBank) serine-type D-Ala-D-Ala carboxypeptidase (A)
MLLVAAATAMVGIAVAQDPAPRPQPAATPAAAAPAASDDLPTPPPPAITGTAWILMDYAT
GQMLAGHNPDERVEPASITKVMTSYVIAAELAAGKIKPDDQVLMSENAWRKGGAGTDGSY
SGFPVNQTAPLLDMEIGMVVQSGNDAAIALAEHVAGSEEAFAQLMNAYAARIGMKNSQFE
NATGLSGPEHYSTARDLAILGRAMVRDFPEEYAHNKIKEFTVGPITQHNRNRLLWRDDSV
DGIKTGHHSGAGYCLMASAQRGDQRLISVVMGSTSEAQRATDSLALLNWGFRFFETHAVY
DAEKSVATQKVWKGKTDEVQLGVAEPMLVSMPRGKYAQLKPSMDIPQTIIAPIEKGQQIG
TVRVMLDDEVVAERPLVALEAVEEAGFFKRLWHEFLMWWNA

BLAST