GenomeNet

>mad:HP15_186 K07637 two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3] | (GenBank) two-component sensor (A)
MTLFSKPKSVKGTLLLLLLPAGIALMGLAWLVHGLLLDRMSREFVETRLKDEVAFLEHQI
LDSGGQLDSLQTGDYFQEVFHHAFAIHSPSRTIISPDSWAPVLTSLIESAKDGTVRVRDA
DTVEGPKNILAYRKSFQIGDTPIVVIVSEDLGALKRSQAELHAWTAIVSILLILLLVVVI
WFGINLSMRPVVELKATLKRLQDGKVSRIHVQAPEEFRPLVQQLNQLLDSLDQRLERSRD
ALANLSHSVKTPIAAVRQILEDTSRPLSNDLRLQMTARLNDIDKQLEAEMRRSRFAGPQV
GKSAYPLKQARDLLWMLGRLYPEKSFELSSSLPEDARWPIEEHDLNEIMGNLLDNAGKWS
DHCVELSLVQRSGTLQMGVIDDGPGVADAEISKLGQRGLRLDEQTPGHGLGLAIVREIVE
RYGGTLRFPTIPERGFSVVVNLPKSASVISH

BLAST