GenomeNet

>mad:HP15_242 K08082 two-component system, LytTR family, sensor histidine kinase AlgZ [EC:2.7.13.3] | (GenBank) histidine kinase internal region (A)
MTESEFFVPDLCRVRAVFLLLVTSELLVLVLAIVQAERGWIDWNYFGLLSLFVQWTTLTS
AALICLLRSRLARMSVSGATTTIVAIVLLDVLAFSLFADSVLHPQDGVAVWQGVAKKMLL
ALLIVLMVLRYFYLQHQWQQQREAEMQAHLASLQARIQPHFLFNSMNTIASLIAINPERA
EEAVLDLSELFRASLRTGDQLIPLSRELALCQRYLAIEALRLGDRLKLEWQIEEGLEHQA
IPPLTLQPLVENAIYHGIQPRPDGGTVRIEAQAKGEFVYLLVQNPKPDQNNQQHDGNRMA
LANIQSRLRALFGEPAVLKHSHQHDVYTVTLRLPRRKAGEQSARKQ

BLAST