GenomeNet

>mad:HP15_724 K10125 two-component system, NtrC family, C4-dicarboxylate transport sensor histidine kinase DctB [EC:2.7.13.3] | (GenBank) periplasmic sensor signal transduction histidine kinase (A)
MPYRIGVFLLFVATLVAAWLLGGWVGYRQVEQESLEESFRYRQLVANELNRYLPVPELMA
EHPLLQRALEAPDNPSAILSANEQMQRMATIVGSSDVYLMDTRGLTIAANNYLQPDSFVG
RNFNFRPYFYEAMESGDSAIYFALGLMSGVRGLYFSHPVRDEGGQIIGVVAVKVLVHELE
SQWDRPTGLREAEMVVLDHNGISFLASRQDWLYRNFSGMADAVPDEYSRRRYPDRDLTPM
ALKTLGTPWGLLEQSATVRIQDSGKPREYLSVSTPLPRMDWTLQVMVSTRSVVWTRLGFA
VGGAALFFGGLLTWLYLRERYRREAELALRGEQLERSVAERTADLENSNRKLVEEIRERE
RTQTELRETQQELIQAAKLAVLGQMSAGLNHEMNQPLTAIQTYARNSRRFLEKGAGEMVD
ANLSEIILLCDKMAELTRQFKVFARKSEGPPAVVDLRQPIDASLKIIVAQQSSSEIDIQW
HRPDSPVMCHGDLIRIEQVMVNLMANAVQAVEGGARPEIRIDIEETEQCWKCLVRDNGPG
LQGDTEQIFEPFFTTKSVKQGLGLGLSISRQIVDALGGSLTGRNRRDGPGAEFVVTLKKR
EAME

BLAST