GenomeNet

>mad:HP15_747 K07639 two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3] | (GenBank) integral membrane sensor signal transduction histidine kinase (A)
MRSQFWHERFPEPLMRWLAAAPAPLQQYHWLSSTVDLRMGAASRFNLSPVALERLGYGQV
VGIDSDVGYRVLVTGLSGEILQLRLNEPYRDVSETIGLIFRWHLDSASADDRLNVASQMA
RSLNVQVQTLDDADLLPDSDVLDQVAERGLAFYTDESDGCGRVIVQLSDGELYRIDMPAG
FDPWAWPVVLLLVLVLGGVLAVAVFLALREVDSNLRTVESVAVRIARGEMSARVQAGEGT
LVTRLASSFNGMAEHIQRLVQVQREMIHAVSHELRTPVARIRFGVQMIEDCQDEAALQRQ
LDGIDGDIQELDELIDEILTYARLEQGGPVFSLQETSITDIVRQVVSEQQMVRPELSIEG
NIDEVSERWALSDIEPRYLHRAIQNLVGNAGRYAAGKVLVSCHFDEDNCRVDVEDDGPGI
PEEDWEKVFTAFARLDDSRTRTSGGYGLGLSIVRRILYWHGGHAFVSRSDTLGGAKFSLV
WPRKKPVDSIV

BLAST