GenomeNet

>mana:MAMMFC1_03358 K03387 NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-] | (GenBank) ahpF; NADH dehydrogenase (A)
MTAAVYAARKRMNAVLVTKEVGGQVMWTMDIENYMGYQFITGPELIAKFEEQVRQFPLKI
KYEEVNRLIVKDDGTFTVVSAEREYHSKTVIIASGKRPKRLGVPGEEEFAGRGVSYCATC
DGPLFAGKNVAVIGGGNSALQAAIELSQVADKVYLVARNNYNADPIVVEKLKKSNNIVEL
SGDTKGIQGSQSVEKLIIASLDSREETDLPVQGVFVEIGLMPNSEYCDGVVKLNDGGEIV
TDCRTRTKIPGLFAAGDVTNGPDKQIVIAAGDGAKAALVAYEYLLHKRPHCG

BLAST