GenomeNet

>masw:AM586_04800 K02433 aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7] | (GenBank) glutamyl-tRNA amidotransferase (A)
MHNKTIKELSTLLHSKQISATELTRHYLDRIAASQHNAFLHVDAELSLAQAQAADARFAE
GSAGPLTGIPIAHKDIFVTKGWRSTAASKMLGNYVSPFDATVVTKFLDAGMVTLGKLNCD
EFAMGSANENSSFGAVQNPWDTLAVPGGSSGGSAAAIAARLAPAATGTDTGGSIRQPAAF
CGITGIKPTYGRVSRFGMIAFASSLDQGGPMARTAEDCALLLNEMVGFDERDSTSLTAEQ
GNAREDFTRQLNQPLNGLRIGVPKEYFGEGLAADVEQAVRAALDQFVKLGATLVEISLPK
TSLSIPVYYIIAPAEASSNLSRFDGVRYGYRTQEYKDLQDMYKKTRAEGFGKEVQRRIMV
GTYVLCHGYYDAYYVQAQKIRRLIADDFQAAFKDKCDVIMGPVAPTVAWDLGAKSDDPVA
NYLADIFTLSTSLAGLPGMSIPVGFGQGEKNAKRPVGLQIIGNYFSEARLLNIAHQYQQA
TDWHTRTPDGV

BLAST