GenomeNet

>mci:Mesci_5990 K02039 phosphate transport system protein | (RefSeq) phosphate transport system regulatory protein PhoU (A)
MQSVHIVSAYDEELKYLSKRIAAMGGHAERMVEQAVTALVNADPGLAQKVIRDDTVLDEG
QREIDDKAIIIIAKRQPMAADLREIVGTIRISADLERVGDLAKNVAKRVVAVTDGRQPTS
LFRGLEALSNLALTQLKEVLDVYASRSVEKIGFVRDRDDQIDAMYTSLFRELLTYMMEDP
RNITPCTHLLFCAKNIERIGDHATNIAETIYYIVTGDQLPAERPKGDKTDKISLSETQPV
K

BLAST